infoalign

Function

Information on a multiple sequence alignment

Description

infoalign is small utility to list some simple properties of sequences in an alignment.

It will write a table containing one line per sequence. The information is written out in columns separated by space or TAB characters. The columns of data are: the sequences' USA, name, two measures of length, counts of gaps, and numbers of identical, similar and different residues or bases in this sequence when compared to a reference sequence, together with a simple statistic of the % change between the reference sequence and this sequence.

The reference sequence can be either the calculated consensus sequence (the default) or it can be one of the set of aligned sequences, specified by either the ordinal number of that sequence in the input file, or by its name.

Any combination of these types of information can be easily selected or unselected.

By default, the output file starts each line with the USA of the sequence being described, so the output file is a list file that can be manually edited and read in by any other EMBOSS program that can read in one or more sequence to be analysed.

Algorithm

The set of aligned sequences is read in.

If the reference sequence is the consensus sequence (this is the default) then this is calculated. If the reference sequence is specified as an ordinal number, then the sequences are counted (from 1) until the reference sequence is identified. If the reference sequence is specified by its name then the names of the sequences are compared to the specified name until the reference sequence is identified.

Foreach sequence:

Find the position of the first residue or base which is not a gap character.
Find the position of the last residue or base which is not a gap character.

Foreach position from the first non-gap character to the last non-gap character:

if the position is a gap character, then
increment the 'GapLen' count
if this character is the start of a new gap, increment the 'Gaps' count
else
the character at this position of the sequence and in the reference sequence are now compared.
if the sequence character and the reference character are identical (apart from case) then
increment the 'Ident' count
else if the similarity matrix score for the two characters is > 0 (i.e. if they are similar) then
increment the 'Similar' count
else
increment the 'Different' count

The 'SeqLen' length of the sequence is the number of non-gap characters in the sequence (i.e. 'Ident' + 'Similar' + 'Different')

The 'AlignLen' length of the sequence is the length from the first non-gap character to the last non-gap character. (i.e. the number of bases or residues of the sequence plus the number of gap characters internal to the sequence.)

The '%Change' value for the sequence is calculated as:
('AlignLen' - 'Ident') * 100 / 'AlignLen'

Usage

Here is a sample session with infoalign


% infoalign ../../data/globins.msf 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the input files for this example
Go to the output files for this example

Example 2

This example doesn't display the USA of the sequence:


% infoalign ../../data/globins.msf -nousa 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 3

Display only the name and sequence length of a sequence:


% infoalign ../../data/globins.msf -only -name -seqlength 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 4

Display only the name, number of gap characters and differences to the consensus sequence:


% infoalign ../../data/globins.msf -only -name -gapcount -diffcount 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 5

Display the name and number of gaps within a sequence:


% infoalign ../../data/globins.msf -only -name -gaps 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 6

Display information formatted with HTML:


% infoalign ../../data/globins.msf -html 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 7

Use the first sequence as the reference sequence to compare to:


% infoalign ../../data/globins.msf -refseq 1 
Information on a multiple sequence alignment
Output file [globins.infoalign]: 

Go to the output files for this example

Example 8


% infoalign -auto tembl:eclac* -out test.out 

Go to the input files for this example
Go to the output files for this example

Example 9


% infoalign -auto tembl:eclacz -out test.out 

Go to the input files for this example
Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqset     The sequence alignment to be displayed.
  [-outfile]           outfile    If you enter the name of a file here then
                                  this program will write the sequence details
                                  into that file.

   Additional (Optional) qualifiers:
   -matrix             matrix     This is the scoring matrix file used when
                                  comparing sequences. By default it is the
                                  file 'EBLOSUM62' (for proteins) or the file
                                  'EDNAFULL' (for nucleic sequences). These
                                  files are found in the 'data' directory of
                                  the EMBOSS installation.
   -refseq             string     If you give the number in the alignment or
                                  the name of a sequence, it will be taken to
                                  be the reference sequence. The reference
                                  sequence is the one against which all the
                                  other sequences are compared. If this is set
                                  to 0 then the consensus sequence will be
                                  used as the reference sequence. By default
                                  the consensus sequence is used as the
                                  reference sequence.
   -html               boolean    Format output as an HTML table

   Advanced (Unprompted) qualifiers:
   -plurality          float      Set a cut-off for the % of positive scoring
                                  matches below which there is no consensus.
                                  The default plurality is taken as 50% of the
                                  total weight of all the sequences in the
                                  alignment.
   -identity           float      Provides the facility of setting the
                                  required number of identities at a position
                                  for it to give a consensus. Therefore, if
                                  this is set to 100% only columns of
                                  identities contribute to the consensus.
   -only               boolean    This is a way of shortening the command line
                                  if you only want a few things to be
                                  displayed. Instead of specifying:
                                  '-nohead -nousa -noname -noalign -nogaps
                                  -nogapcount -nosimcount -noidcount
                                  -nodiffcount'
                                  to get only the sequence length output, you
                                  can specify
                                  '-only -seqlength'
   -heading            boolean    Display column headings
   -usa                boolean    Display the USA of the sequence
   -name               boolean    Display 'name' column
   -seqlength          boolean    Display 'seqlength' column
   -alignlength        boolean    Display 'alignlength' column
   -gaps               boolean    Display number of gaps
   -gapcount           boolean    Display number of gap positions
   -idcount            boolean    Display number of identical positions
   -simcount           boolean    Display number of similar positions
   -diffcount          boolean    Display number of different positions
   -change             boolean    Display % number of changed positions
   -description        boolean    Display 'description' column

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1             integer    Start of each sequence to be used
   -send1               integer    End of each sequence to be used
   -sreverse1           boolean    Reverse (if DNA)
   -sask1               boolean    Ask for begin/end/reverse
   -snucleotide1        boolean    Sequence is nucleotide
   -sprotein1           boolean    Sequence is protein
   -slower1             boolean    Make lower case
   -supper1             boolean    Make upper case
   -sformat1            string     Input sequence format
   -sdbname1            string     Database name
   -sid1                string     Entryname
   -ufo1                string     UFO features
   -fformat1            string     Features format
   -fopenfile1          string     Features file name

   "-outfile" associated qualifiers
   -odirectory2         string     Output directory

   General qualifiers:
   -auto                boolean    Turn off prompts
   -stdout              boolean    Write standard output
   -filter              boolean    Read standard input, write standard output
   -options             boolean    Prompt for standard and additional values
   -debug               boolean    Write debug output to program.dbg
   -verbose             boolean    Report some/full command line options
   -help                boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning             boolean    Report warnings
   -error               boolean    Report errors
   -fatal               boolean    Report fatal errors
   -die                 boolean    Report deaths


Standard (Mandatory) qualifiers Allowed values Default
[-sequence]
(Parameter 1)
The sequence alignment to be displayed. Readable set of sequences Required
[-outfile]
(Parameter 2)
If you enter the name of a file here then this program will write the sequence details into that file. Output file <sequence>.infoalign
Additional (Optional) qualifiers Allowed values Default
-matrix This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation. Comparison matrix file in EMBOSS data path EBLOSUM62 for protein
EDNAFULL for DNA
-refseq If you give the number in the alignment or the name of a sequence, it will be taken to be the reference sequence. The reference sequence is the one against which all the other sequences are compared. If this is set to 0 then the consensus sequence will be used as the reference sequence. By default the consensus sequence is used as the reference sequence. Any string is accepted 0
-html Format output as an HTML table Boolean value Yes/No No
Advanced (Unprompted) qualifiers Allowed values Default
-plurality Set a cut-off for the % of positive scoring matches below which there is no consensus. The default plurality is taken as 50% of the total weight of all the sequences in the alignment. Number from 0.000 to 100.000 50.0
-identity Provides the facility of setting the required number of identities at a position for it to give a consensus. Therefore, if this is set to 100% only columns of identities contribute to the consensus. Number from 0.000 to 100.000 0.0
-only This is a way of shortening the command line if you only want a few things to be displayed. Instead of specifying: '-nohead -nousa -noname -noalign -nogaps -nogapcount -nosimcount -noidcount -nodiffcount' to get only the sequence length output, you can specify '-only -seqlength' Boolean value Yes/No No
-heading Display column headings Boolean value Yes/No @(!$(only))
-usa Display the USA of the sequence Boolean value Yes/No @(!$(only))
-name Display 'name' column Boolean value Yes/No @(!$(only))
-seqlength Display 'seqlength' column Boolean value Yes/No @(!$(only))
-alignlength Display 'alignlength' column Boolean value Yes/No @(!$(only))
-gaps Display number of gaps Boolean value Yes/No @(!$(only))
-gapcount Display number of gap positions Boolean value Yes/No @(!$(only))
-idcount Display number of identical positions Boolean value Yes/No @(!$(only))
-simcount Display number of similar positions Boolean value Yes/No @(!$(only))
-diffcount Display number of different positions Boolean value Yes/No @(!$(only))
-change Display % number of changed positions Boolean value Yes/No @(!$(only))
-description Display 'description' column Boolean value Yes/No @(!$(only))

Input file format

infoalign reads a normal multiple sequence alignment file, as produced by a alignment program.

Input files for usage example

File: ../../data/globins.msf

!!AA_MULTIPLE_ALIGNMENT 1.0

  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..

  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.14
  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.15
  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.15
  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.19
  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 0.23
  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.21
  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.10

//

           1                                               50
HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQR
HBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQR
HBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLS
HBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLG
MYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLE
GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE
LGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD

           51                                             100
HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE
HBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE
HBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD
HBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSD
MYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ
GLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD
LGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN

           101                                            150
HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA
HBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA
HBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
HBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVS
MYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR
GLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA
LGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA

           151        164
HBB_HUMAN  NALAHKYH~~~~~~
HBB_HORSE  NALAHKYH~~~~~~
HBA_HUMAN  TVLTSKYR~~~~~~
HBA_HORSE  TVLTSKYR~~~~~~
MYG_PHYCA  KDIAAKYKELGYQG
GLB5_PETMA Y~~~~~~~~~~~~~
LGB2_LUPLU IVIKKEMNDAA~~~

Input files for usage example 8

'tembl:eclac*' is a sequence entry in the example nucleic acid database 'tembl'

Input files for usage example 9

Database entry: tembl:eclacz

ID   ECLACZ     standard; DNA; PRO; 3078 BP.
XX
AC   V00296;
XX
SV   V00296.1
XX
DT   13-JUL-1983 (Rel. 03, Created)
DT   06-MAR-1996 (Rel. 47, Last updated, Version 4)
XX
DE   E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).
XX
KW   galactosidase.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
OC   Escherichia.
XX
RN   [1]
RP   1-3078
RX   MEDLINE; 84028567.
RA   Kalnins A., Otto K., Ruether U., Mueller-Hill B.;
RT   "Sequence of the lacZ gene of Escherichia coli";
RL   EMBO J. 2:593-597(1983).
XX
RN   [2]
RX   MEDLINE; 87275876.
RA   Zell R., Fritz H.J.;
RT   "DNA mismatch-repair in Escherichia coli counteracting the hydrolytic
RT   deamination of 5-methyl-cytosine residues";
RL   EMBO J. 6:1809-1815(1987).
XX
DR   SWISS-PROT; P00722; BGAL_ECOLI.
XX
CC   Data kindly reviewed (18-MAY-1983) by U. Ruether
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3078
FT                   /db_xref="taxon:562"
FT                   /organism="Escherichia coli"
FT   CDS             <1..3072
FT                   /db_xref="SWISS-PROT:P00722"
FT                   /note="galactosidase"
FT                   /transl_table=11
FT                   /protein_id="CAA23573.1"
FT                   /translation="TMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD
FT                   RPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVT
FT                   YPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQ
FT                   DSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQI
FT                   SDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDE


  [Part of this file has been deleted for brevity]

     gaggcccgca ccgatcgccc ttcccaacag ttgcgcagcc tgaatggcga atggcgcttt       180
     gcctggtttc cggcaccaga agcggtgccg gaaagctggc tggagtgcga tcttcctgag       240
     gccgatactg tcgtcgtccc ctcaaactgg cagatgcacg gttacgatgc gcccatctac       300
     accaacgtaa cctatcccat tacggtcaat ccgccgtttg ttcccacgga gaatccgacg       360
     ggttgttact cgctcacatt taatgttgat gaaagctggc tacaggaagg ccagacgcga       420
     attatttttg atggcgttaa ctcggcgttt catctgtggt gcaacgggcg ctgggtcggt       480
     tacggccagg acagtcgttt gccgtctgaa tttgacctga gcgcattttt acgcgccgga       540
     gaaaaccgcc tcgcggtgat ggtgctgcgt tggagtgacg gcagttatct ggaagatcag       600
     gatatgtggc ggatgagcgg cattttccgt gacgtctcgt tgctgcataa accgactaca       660
     caaatcagcg atttccatgt tgccactcgc tttaatgatg atttcagccg cgctgtactg       720
     gaggctgaag ttcagatgtg cggcgagttg cgtgactacc tacgggtaac agtttcttta       780
     tggcagggtg aaacgcaggt cgccagcggc accgcgcctt tcggcggtga aattatcgat       840
     gagcgtggtg gttatgccga tcgcgtcaca ctacgtctga acgtcgaaaa cccgaaactg       900
     tggagcgccg aaatcccgaa tctctatcgt gcggtggttg aactgcacac cgccgacggc       960
     acgctgattg aagcagaagc ctgcgatgtc ggtttccgcg aggtgcggat tgaaaatggt      1020
     ctgctgctgc tgaacggcaa gccgttgctg attcgaggcg ttaaccgtca cgagcatcat      1080
     cctctgcatg gtcaggtcat ggatgagcag acgatggtgc aggatatcct gctgatgaag      1140
     cagaacaact ttaacgccgt gcgctgttcg cattatccga accatccgct gtggtacacg      1200
     ctgtgcgacc gctacggcct gtatgtggtg gatgaagcca atattgaaac ccacggcatg      1260
     gtgccaatga atcgtctgac cgatgatccg cgctggctac cggcgatgag cgaacgcgta      1320
     acgcgaatgg tgcagcgcga tcgtaatcac ccgagtgtga tcatctggtc gctggggaat      1380
     gaatcaggcc acggcgctaa tcacgacgcg ctgtatcgct ggatcaaatc tgtcgatcct      1440
     tcccgcccgg tgcagtatga aggcggcgga gccgacacca cggccaccga tattatttgc      1500
     ccgatgtacg cgcgcgtgga tgaagaccag cccttcccgg ctgtgccgaa atggtccatc      1560
     aaaaaatggc tttcgctacc tggagagacg cgcccgctga tcctttgcga atacgcccac      1620
     gcgatgggta acagtcttgg cggtttcgct aaatactggc aggcgtttcg tcagtatccc      1680
     cgtttacagg gcggcttcgt ctgggactgg gtggatcagt cgctgattaa atatgatgaa      1740
     aacggcaacc cgtggtcggc ttacggcggt gattttggcg atacgccgaa cgatcgccag      1800
     ttctgtatga acggtctggt ctttgccgac cgcacgccgc atccagcgct gacggaagca      1860
     aaacaccagc agcagttttt ccagttccgt ttatccgggc aaaccatcga agtgaccagc      1920
     gaatacctgt tccgtcatag cgataacgag ctcctgcact ggatggtggc gctggatggt      1980
     aagccgctgg caagcggtga agtgcctctg gatgtcgctc cacaaggtaa acagttgatt      2040
     gaactgcctg aactaccgca gccggagagc gccgggcaac tctggctcac agtacgcgta      2100
     gtgcaaccga acgcgaccgc atggtcagaa gccgggcaca tcagcgcctg gcagcagtgg      2160
     cgtctggcgg aaaacctcag tgtgacgctc cccgccgcgt cccacgccat cccgcatctg      2220
     accaccagcg aaatggattt ttgcatcgag ctgggtaata agcgttggca atttaaccgc      2280
     cagtcaggct ttctttcaca gatgtggatt ggcgataaaa aacaactgct gacgccgctg      2340
     cgcgatcagt tcacccgtgc accgctggat aacgacattg gcgtaagtga agcgacccgc      2400
     attgacccta acgcctgggt cgaacgctgg aaggcggcgg gccattacca ggccgaagca      2460
     gcgttgttgc agtgcacggc agatacactt gctgatgcgg tgctgattac gaccgctcac      2520
     gcgtggcagc atcaggggaa aaccttattt atcagccgga aaacctaccg gattgatggt      2580
     agtggtcaaa tggcgattac cgttgatgtt gaagtggcga gcgatacacc gcatccggcg      2640
     cggattggcc tgaactgcca gctggcgcag gtagcagagc gggtaaactg gctcggatta      2700
     gggccgcaag aaaactatcc cgaccgcctt actgccgcct gttttgaccg ctgggatctg      2760
     ccattgtcag acatgtatac cccgtacgtc ttcccgagcg aaaacggtct gcgctgcggg      2820
     acgcgcgaat tgaattatgg cccacaccag tggcgcggcg acttccagtt caacatcagc      2880
     cgctacagtc aacagcaact gatggaaacc agccatcgcc atctgctgca cgcggaagaa      2940
     ggcacatggc tgaatatcga cggtttccat atggggattg gtggcgacga ctcctggagc      3000
     ccgtcagtat cggcggaatt ccagctgagc gccggtcgct accattacca gttggtctgg      3060
     tgtcaaaaat aataataa                                                    3078
//

Output file format

Output files for usage example

File: globins.infoalign

# USA             Name        SeqLen	AlignLen	Gaps	GapLen	Ident	Similar	Differ	% Change	Description
msf::../../data/globins.msf:HBB_HUMAN	HBB_HUMAN     146	150	3	4	48	10	88	68.000000	
msf::../../data/globins.msf:HBB_HORSE	HBB_HORSE     146	150	3	4	48	10	88	68.000000	
msf::../../data/globins.msf:HBA_HUMAN	HBA_HUMAN     141	144	2	3	45	7	89	68.750000	
msf::../../data/globins.msf:HBA_HORSE	HBA_HORSE     141	144	2	3	48	4	89	66.666664	
msf::../../data/globins.msf:MYG_PHYCA	MYG_PHYCA     153	157	3	4	25	13	115	84.076431	
msf::../../data/globins.msf:GLB5_PETMA	GLB5_PETMA    149	151	1	2	21	13	115	86.092712	
msf::../../data/globins.msf:LGB2_LUPLU	LGB2_LUPLU    153	153	0	0	11	20	122	92.810455	

Output files for usage example 2

File: globins.infoalign

# Name        SeqLen	AlignLen	Gaps	GapLen	Ident	Similar	Differ	% Change	Description
HBB_HUMAN     146	150	3	4	48	10	88	68.000000	
HBB_HORSE     146	150	3	4	48	10	88	68.000000	
HBA_HUMAN     141	144	2	3	45	7	89	68.750000	
HBA_HORSE     141	144	2	3	48	4	89	66.666664	
MYG_PHYCA     153	157	3	4	25	13	115	84.076431	
GLB5_PETMA    149	151	1	2	21	13	115	86.092712	
LGB2_LUPLU    153	153	0	0	11	20	122	92.810455	

Output files for usage example 3

File: globins.infoalign

HBB_HUMAN     146
HBB_HORSE     146
HBA_HUMAN     141
HBA_HORSE     141
MYG_PHYCA     153
GLB5_PETMA    149
LGB2_LUPLU    153

Output files for usage example 4

File: globins.infoalign

HBB_HUMAN     4	88
HBB_HORSE     4	88
HBA_HUMAN     3	89
HBA_HORSE     3	89
MYG_PHYCA     4	115
GLB5_PETMA    2	115
LGB2_LUPLU    0	122

Output files for usage example 5

File: globins.infoalign

HBB_HUMAN     3
HBB_HORSE     3
HBA_HUMAN     2
HBA_HORSE     2
MYG_PHYCA     3
GLB5_PETMA    1
LGB2_LUPLU    0

Output files for usage example 6

File: globins.infoalign

<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>USA</th><th>Name</th><th>Sequence Length</th><th>Aligned Length</th><th>Gaps</th><th>Gap Length</th><th>Identity</th><th>Similarity</th><th>Difference</th><th>% Change</th><th>Description</th></tr>
<tr><td>msf::../../data/globins.msf:HBB_HUMAN</td>
<td>HBB_HUMAN</td>
<td>146</td>
<td>150</td>
<td>3</td>
<td>4</td>
<td>48</td>
<td>10</td>
<td>88</td>
<td>68.000000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBB_HORSE</td>
<td>HBB_HORSE</td>
<td>146</td>
<td>150</td>
<td>3</td>
<td>4</td>
<td>48</td>
<td>10</td>
<td>88</td>
<td>68.000000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBA_HUMAN</td>
<td>HBA_HUMAN</td>
<td>141</td>
<td>144</td>
<td>2</td>
<td>3</td>
<td>45</td>
<td>7</td>
<td>89</td>
<td>68.750000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBA_HORSE</td>
<td>HBA_HORSE</td>
<td>141</td>
<td>144</td>
<td>2</td>
<td>3</td>
<td>48</td>
<td>4</td>
<td>89</td>
<td>66.666664</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:MYG_PHYCA</td>
<td>MYG_PHYCA</td>
<td>153</td>
<td>157</td>
<td>3</td>
<td>4</td>
<td>25</td>
<td>13</td>
<td>115</td>
<td>84.076431</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:GLB5_PETMA</td>
<td>GLB5_PETMA</td>
<td>149</td>
<td>151</td>
<td>1</td>
<td>2</td>
<td>21</td>
<td>13</td>
<td>115</td>
<td>86.092712</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:LGB2_LUPLU</td>
<td>LGB2_LUPLU</td>
<td>153</td>
<td>153</td>
<td>0</td>
<td>0</td>
<td>11</td>
<td>20</td>
<td>122</td>
<td>92.810455</td>
<td></td>
</tr>
</table>

Output files for usage example 7

File: globins.infoalign

# USA             Name        SeqLen	AlignLen	Gaps	GapLen	Ident	Similar	Differ	% Change	Description
msf::../../data/globins.msf:HBB_HUMAN	HBB_HUMAN     146	150	3	4	146	0	0	2.666667	
msf::../../data/globins.msf:HBB_HORSE	HBB_HORSE     146	150	3	4	122	10	14	18.666666	
msf::../../data/globins.msf:HBA_HUMAN	HBA_HUMAN     141	144	2	3	48	19	74	66.666664	
msf::../../data/globins.msf:HBA_HORSE	HBA_HORSE     141	144	2	3	51	18	72	64.583336	
msf::../../data/globins.msf:MYG_PHYCA	MYG_PHYCA     153	157	3	4	30	22	101	80.891716	
msf::../../data/globins.msf:GLB5_PETMA	GLB5_PETMA    149	151	1	2	24	27	98	84.105957	
msf::../../data/globins.msf:LGB2_LUPLU	LGB2_LUPLU    153	153	0	0	21	28	104	86.274513	

Output files for usage example 8

File: test.out

# USA             Name        SeqLen	AlignLen	Gaps	GapLen	Ident	Similar	Differ	% Change	Description
tembl-id:ECLAC    ECLAC         7477	7477	0	0	65	0	7412	99.130669	E.coli lactose operon with lacI, lacZ, lacY and lacA genes.
tembl-id:ECLACA   ECLACA        1832	1832	0	0	71	0	1761	96.124451	Escherichia coli lacA gene for thiogalactoside transacetylase
tembl-id:ECLACI   ECLACI        1113	1113	0	0	67	0	1046	93.980232	E. coli laci gene (codes for the lac repressor).
tembl-id:ECLACY   ECLACY        1500	1500	0	0	68	0	1432	95.466667	E. coli lacY gene (codes for lactose permease).
tembl-id:ECLACZ   ECLACZ        3078	3078	0	0	72	0	3006	97.660820	E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).

Output files for usage example 9

File: test.out

# USA             Name        SeqLen	AlignLen	Gaps	GapLen	Ident	Similar	Differ	% Change	Description
tembl-id:ECLACZ   ECLACZ        3078	3078	0	0	0	0	3078	100.000000	E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).

The first non-blank line is the heading. This is followed by one line per sequence containing the following columns of data separated by one of more space or TAB characters:

If qualifiers to inhibit various columns of information are used, then the remaining columns of information are output in the same order as shown above, so if '-noseqlength' is used, the order of output is: usa, name, alignlength, gaps, gapcount, idcount, simcount, diffcount, change, description.

When the -html qualifier is specified, then the output will be wrapped in HTML tags, ready for inclusion in a Web page. Note that tags such as and are not output by this program as the table of databases is expected to form only part of the contents of a web page - the rest of the web page must be supplier by the user.

The lines of output information are guaranteed not to have trailing white-space at the end.

Data files

infoalign reads in scoring matrices to determine the consensus sequence and to determine which matches are similar or not.

EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA.

To see the available EMBOSS data files, run:

% embossdata -showall

To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:


% embossdata -fetch -file Exxx.dat

Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".

The directories are searched in the following order:

Notes

By default, the output file starts each line with the USA of the sequence being described, so the output file is a list file that can be manually edited and read in by other EMBOSS programs using the list-file specification of '@filename'.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program nameDescription
emmaMultiple alignment program - interface to ClustalW program
infoseqDisplays some simple information about sequences
plotconPlots the quality of conservation of a sequence alignment
prettyplotDisplays aligned sequences, with colouring and boxing
seealsoFinds programs sharing group names
showalignDisplays a multiple sequence alignment
showdbDisplays information on the currently available databases
textsearchSearch sequence documentation text. SRS and Entrez are faster!
tfmDisplays a program's help documentation manual
tranalignAlign nucleic coding regions given the aligned proteins
whichdbSearch all databases for an entry
wossnameFinds programs by keywords in their one-line documentation

Author(s)

Gary Williams (gwilliam © rfcgr.mrc.ac.uk)
MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SB, UK

History

Written (June 2001) - Gary Williams

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments